| Name | ZDHHC13 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1661 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | ZDHHC13 antibody was raised using the N terminal of ZDHHC13 corresponding to a region with amino acids MVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDV |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | ZDHHC13 Blocking Peptide |
| Description | Rabbit polyclonal ZDHHC13 antibody raised against the N terminal of ZDHHC13 |
| Gene | ZDHHC13 |
| Supplier Page | Shop |