Name | ZDHHC13 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1661 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | IHC WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | ZDHHC13 antibody was raised using the N terminal of ZDHHC13 corresponding to a region with amino acids MVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDV |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | ZDHHC13 Blocking Peptide |
Description | Rabbit polyclonal ZDHHC13 antibody raised against the N terminal of ZDHHC13 |
Gene | ZDHHC13 |
Supplier Page | Shop |