TJAP1 antibody

Name TJAP1 antibody
Supplier Fitzgerald
Catalog 70R-2943
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen TJAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGTSHTEGRAWPLPSSSRPQRSPKRMGVHHLHRKDSLTQAQEQGNLLN
Purity/Format Affinity purified
Blocking Peptide TJAP1 Blocking Peptide
Description Rabbit polyclonal TJAP1 antibody
Gene TJAP1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.