| Name | Granulysin antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2751 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Granulysin antibody was raised using the N terminal of GNLY corresponding to a region with amino acids MASGPLGPGARPTRLHPPFPPPAHIKPGAPPGENPELSGLERILARHQLP |
| Purity/Format | Affinity purified |
| Blocking Peptide | Granulysin Blocking Peptide |
| Description | Rabbit polyclonal Granulysin antibody raised against the n terminal of GNLY |
| Gene | GNLY |
| Supplier Page | Shop |