| Name | MGC4172 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6992 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | MGC4172 antibody was raised using the C terminal of MGC4172 corresponding to a region with amino acids VETQFAFKLHDKDPEKAAATYEQMKCLKPEDVAEAVIYVLSTPAHIQIGD |
| Purity/Format | Affinity purified |
| Blocking Peptide | MGC4172 Blocking Peptide |
| Description | Rabbit polyclonal MGC4172 antibody raised against the C terminal of MGC4172 |
| Gene | DHRS11 |
| Supplier Page | Shop |