| Name | PRODH2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2398 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Dog |
| Antigen | PRODH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGIPLDGTVCFGQLLGMCDHVSLALGQAGYVVYKSIPYGSLEEVIPYLIR |
| Purity/Format | Affinity purified |
| Blocking Peptide | PRODH2 Blocking Peptide |
| Description | Rabbit polyclonal PRODH2 antibody |
| Gene | PRODH2 |
| Supplier Page | Shop |