GABRA5 antibody

Name GABRA5 antibody
Supplier Fitzgerald
Catalog 70R-5218
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen GABRA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKIKKKREVILNKSTNAFTTGKMSHPPNIPKEQTPAGTSNTTSVSVKPSE
Purity/Format Affinity purified
Blocking Peptide GABRA5 Blocking Peptide
Description Rabbit polyclonal GABRA5 antibody
Gene GABRA5
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.