TUSC1 antibody

Name TUSC1 antibody
Supplier Fitzgerald
Catalog 70R-2591
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Rat
Antigen TUSC1 antibody was raised using the middle region of TUSC1 corresponding to a region with amino acids DSGREDEPGSPRALRARLEKLEAMYRRALLQLHLEQRGPRPSGDKEEQPL
Purity/Format Affinity purified
Blocking Peptide TUSC1 Blocking Peptide
Description Rabbit polyclonal TUSC1 antibody raised against the middle region of TUSC1
Gene TUSC1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.