| Name | Tetraspanin 5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7185 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | Tetraspanin 5 antibody was raised using the middle region of TSPAN5 corresponding to a region with amino acids ASRERCGVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | Tetraspanin 5 Blocking Peptide |
| Description | Rabbit polyclonal Tetraspanin 5 antibody raised against the middle region of TSPAN5 |
| Gene | TSPAN5 |
| Supplier Page | Shop |