| Name | FMO5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6639 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | FMO5 antibody was raised using the middle region of FMO5 corresponding to a region with amino acids NKYLEKKINQRFDHEMFGLKPKHRALSQHPTLNDDLPNRIISGLVKVKGN |
| Purity/Format | Affinity purified |
| Blocking Peptide | FMO5 Blocking Peptide |
| Description | Rabbit polyclonal FMO5 antibody raised against the middle region of FMO5 |
| Gene | FMO5 |
| Supplier Page | Shop |