| Name | PLD3 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6831 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | PLD3 antibody was raised using the N terminal of PLD3 corresponding to a region with amino acids WVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVE |
| Purity/Format | Affinity purified |
| Blocking Peptide | PLD3 Blocking Peptide |
| Description | Rabbit polyclonal PLD3 antibody raised against the N terminal of PLD3 |
| Gene | PLD3 |
| Supplier Page | Shop |