RARA antibody

Name RARA antibody
Supplier Fitzgerald
Catalog 70R-4609
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen RARA antibody was raised using the N terminal of RARA corresponding to a region with amino acids YESVEVGGPTPNPFLVVDFYNQNRACLLPEKGLPAPGPYSTPLRTPLWNG
Purity/Format Affinity purified
Blocking Peptide RARA Blocking Peptide
Description Rabbit polyclonal RARA antibody raised against the N terminal of RARA
Gene RARA
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.