| Name | TMCC1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6287 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | TMCC1 antibody was raised using the middle region of TMCC1 corresponding to a region with amino acids YQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARNLLGK |
| Purity/Format | Affinity purified |
| Blocking Peptide | TMCC1 Blocking Peptide |
| Description | Rabbit polyclonal TMCC1 antibody raised against the middle region of TMCC1 |
| Gene | TMCC1 |
| Supplier Page | Shop |