| Name | MDP1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3521 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | MDP1 antibody was raised using the N terminal Of Mdp-1 corresponding to a region with amino acids MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPE |
| Purity/Format | Affinity purified |
| Blocking Peptide | MDP1 Blocking Peptide |
| Description | Rabbit polyclonal MDP-1 antibody raised against the N terminal Of Mdp-1 |
| Gene | MDP1 |
| Supplier Page | Shop |