AADACL4 antibody

Name AADACL4 antibody
Supplier Fitzgerald
Catalog 70R-6671
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen AADACL4 antibody was raised using the N terminal of AADACL4 corresponding to a region with amino acids FIRFLHDSVRIKKDPELVVTDLRFGTIPVRLFQPKAASSRPRRGIIFYHG
Purity/Format Affinity purified
Blocking Peptide AADACL4 Blocking Peptide
Description Rabbit polyclonal AADACL4 antibody raised against the N terminal of AADACL4
Gene AADACL4
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.