| Name | HIPK1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2078 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | HIPK1 antibody was raised using the middle region of HIPK1 corresponding to a region with amino acids PLNLSQNQQSSAAPTSQERSSNPAPRRQQAFVAPLSQAPYTFQHGSPLHS |
| Purity/Format | Affinity purified |
| Blocking Peptide | HIPK1 Blocking Peptide |
| Description | Rabbit polyclonal HIPK1 antibody raised against the middle region of HIPK1 |
| Gene | HIPK1 |
| Supplier Page | Shop |