| Name | FUT6 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5379 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FUT6 antibody was raised using the C terminal of FUT6 corresponding to a region with amino acids YITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLAR |
| Purity/Format | Affinity purified |
| Blocking Peptide | FUT6 Blocking Peptide |
| Description | Rabbit polyclonal FUT6 antibody raised against the C terminal of FUT6 |
| Gene | FUT6 |
| Supplier Page | Shop |