| Name | CHIC2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6863 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | CHIC2 antibody was raised using the N terminal of CHIC2 corresponding to a region with amino acids EEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASI |
| Purity/Format | Affinity purified |
| Blocking Peptide | CHIC2 Blocking Peptide |
| Description | Rabbit polyclonal CHIC2 antibody raised against the N terminal of CHIC2 |
| Gene | CHIC2 |
| Supplier Page | Shop |