| Name | SRP68 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4641 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | SRP68 antibody was raised using the N terminal of SRP68 corresponding to a region with amino acids EENKENERPSAGSKANKEFGDSLSLEILQIIKESQQQHGLRHGDFQRYRG |
| Purity/Format | Affinity purified |
| Blocking Peptide | SRP68 Blocking Peptide |
| Description | Rabbit polyclonal SRP68 antibody raised against the N terminal of SRP68 |
| Gene | SRP68 |
| Supplier Page | Shop |