| Name | MFAP3L antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1726 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | MFAP3L antibody was raised using the N terminal of MFAP3L corresponding to a region with amino acids MHDSGLLNITKVSFSDRGKYTCVASNIYGTVNNTVTLRVIFTSGDMGVYY |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | MFAP3L Blocking Peptide |
| Description | Rabbit polyclonal MFAP3L antibody raised against the N terminal of MFAP3L |
| Gene | MFAP3L |
| Supplier Page | Shop |