Name | GHRHR antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-7057 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | GHRHR antibody was raised using the C terminal of GHRHR corresponding to a region with amino acids YWWIIKGPIVLSVGVNFGLFLNIIRILVRKLEPAQGSLHTQSQYWYCVFV |
Purity/Format | Affinity purified |
Blocking Peptide | GHRHR Blocking Peptide |
Description | Rabbit polyclonal GHRHR antibody raised against the C terminal of GHRHR |
Gene | GHRHR |
Supplier Page | Shop |