GHRHR antibody

Name GHRHR antibody
Supplier Fitzgerald
Catalog 70R-7057
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen GHRHR antibody was raised using the C terminal of GHRHR corresponding to a region with amino acids YWWIIKGPIVLSVGVNFGLFLNIIRILVRKLEPAQGSLHTQSQYWYCVFV
Purity/Format Affinity purified
Blocking Peptide GHRHR Blocking Peptide
Description Rabbit polyclonal GHRHR antibody raised against the C terminal of GHRHR
Gene GHRHR
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.