Anti-GNL1 antibody
| Name | Anti-GNL1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab130915 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Rat, Human, Mouse, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Pig, Chimpanzee, Monkey, Orangutan |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 439-488 ( EPYTSVGYLACRIPVQALLHLRHPEAEDPSAEHPWCAWDVCEAWAEKRGY ) of Rat Gnl1 (NP_997665) |
| Description | Rabbit Polyclonal |
| Gene | GNL1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-GNL1 antibody (ab130915) at 1 µg/ml + Rat Spleen lysates