PERLD1 antibody

Name PERLD1 antibody
Supplier Fitzgerald
Catalog 70R-7447
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen PERLD1 antibody was raised using the N terminal of PERLD1 corresponding to a region with amino acids ECMWVTVGLYLQEGHKVPQFHGKWPFSRFLFFQEPASAVASFLNGLASLV
Purity/Format Affinity purified
Blocking Peptide PERLD1 Blocking Peptide
Description Rabbit polyclonal PERLD1 antibody raised against the N terminal of PERLD1
Gene CACNB2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.