| Name | CCDC60 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4198 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | CCDC60 antibody was raised using the C terminal of CCDC60 corresponding to a region with amino acids RPAKKILVKLQKFGENLDLRIRPHVLLKVLQDLRIWELCSPDIAVAIEFV |
| Purity/Format | Affinity purified |
| Blocking Peptide | CCDC60 Blocking Peptide |
| Description | Rabbit polyclonal CCDC60 antibody raised against the C terminal of CCDC60 |
| Gene | CCDC60 |
| Supplier Page | Shop |