CCR2 antibody

Name CCR2 antibody
Supplier Fitzgerald
Catalog 70R-5967
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen CCR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILL
Purity/Format Affinity purified
Blocking Peptide CCR2 Blocking Peptide
Description Rabbit polyclonal CCR2 antibody
Gene CCR2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.