| Name | BLK antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1644 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | BLK antibody was raised using the middle region of BLK corresponding to a region with amino acids AVVTKEPIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQIAEGMAY |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | BLK Blocking Peptide |
| Description | Rabbit polyclonal BLK antibody raised against the middle region of BLK |
| Gene | BLK |
| Supplier Page | Shop |