PRMT8 antibody

Name PRMT8 antibody
Supplier Fitzgerald
Catalog 70R-1263
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Dog
Antigen PRMT8 antibody was raised using the C terminal of PRMT8 corresponding to a region with amino acids YLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSND
Purity/Format Total IgG Protein A purified
Blocking Peptide PRMT8 Blocking Peptide
Description Rabbit polyclonal PRMT8 antibody raised against the C terminal of PRMT8
Gene PRMT8
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.