PLCD1 antibody

Name PLCD1 antibody
Supplier Fitzgerald
Catalog 70R-5852
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen PLCD1 antibody was raised using the N terminal of PLCD1 corresponding to a region with amino acids DIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQH
Purity/Format Affinity purified
Blocking Peptide PLCD1 Blocking Peptide
Description Rabbit polyclonal PLCD1 antibody raised against the N terminal of PLCD1
Gene PLCD1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.