| Name | CDKN2AIP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4954 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CDKN2AIP antibody was raised using the N terminal of CDKN2AIP corresponding to a region with amino acids RRDFLLRNAGDLAPAGGAASASTDEAADAESGTRNRQLQQLISFSMAWAN |
| Purity/Format | Affinity purified |
| Blocking Peptide | CDKN2AIP Blocking Peptide |
| Description | Rabbit polyclonal CDKN2AIP antibody raised against the N terminal of CDKN2AIP |
| Gene | CDKN2AIP |
| Supplier Page | Shop |