Name | C1ORF116 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3844 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | C1ORF116 antibody was raised using the middle region of C1Orf116 corresponding to a region with amino acids SGLTLQESNTPGLRQMNFKSNTLERSGVGLSSYLSTEKDASPKTSTSLGK |
Purity/Format | Affinity purified |
Blocking Peptide | C1ORF116 Blocking Peptide |
Description | Rabbit polyclonal C1ORF116 antibody raised against the middle region of C1Orf116 |
Gene | C1orf116 |
Supplier Page | Shop |