C1ORF116 antibody

Name C1ORF116 antibody
Supplier Fitzgerald
Catalog 70R-3844
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen C1ORF116 antibody was raised using the middle region of C1Orf116 corresponding to a region with amino acids SGLTLQESNTPGLRQMNFKSNTLERSGVGLSSYLSTEKDASPKTSTSLGK
Purity/Format Affinity purified
Blocking Peptide C1ORF116 Blocking Peptide
Description Rabbit polyclonal C1ORF116 antibody raised against the middle region of C1Orf116
Gene C1orf116
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.