| Name | TRIML1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2273 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | TRIML1 antibody was raised using the middle region of TRIML1 corresponding to a region with amino acids DSVSRKGNLPKPPGDLFSLIGLKIGDDYSLWVSSPLKGQHVREPVCKVGV |
| Purity/Format | Affinity purified |
| Blocking Peptide | TRIML1 Blocking Peptide |
| Description | Rabbit polyclonal TRIML1 antibody raised against the middle region of TRIML1 |
| Gene | TRIML1 |
| Supplier Page | Shop |