| Name | CC2D1B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1958 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | CC2D1B antibody was raised using the C terminal of CC2D1B corresponding to a region with amino acids IVRGMNLPAPPGVTPDDLDAFVRFEFHYPNSDQAQKSKTAVVKNTNSPEF |
| Purity/Format | Affinity purified |
| Blocking Peptide | CC2D1B Blocking Peptide |
| Description | Rabbit polyclonal CC2D1B antibody raised against the C terminal of CC2D1B |
| Gene | CC2D1B |
| Supplier Page | Shop |