| Name | DTNB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3432 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | DTNB antibody was raised using the C terminal of DTNB corresponding to a region with amino acids ASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEEL |
| Purity/Format | Affinity purified |
| Blocking Peptide | DTNB Blocking Peptide |
| Description | Rabbit polyclonal DTNB antibody raised against the C terminal of DTNB |
| Gene | DTNB |
| Supplier Page | Shop |