AIFM3 antibody

Name AIFM3 antibody
Supplier Fitzgerald
Catalog 70R-2470
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen AIFM3 antibody was raised using the middle region of AIFM3 corresponding to a region with amino acids EGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLALRPKEFFRAYGIEVL
Purity/Format Affinity purified
Blocking Peptide AIFM3 Blocking Peptide
Description Rabbit polyclonal AIFM3 antibody raised against the middle region of AIFM3
Gene AIFM3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.