Calmegin antibody

Name Calmegin antibody
Supplier Fitzgerald
Catalog 70R-1894
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Calmegin antibody was raised using the N terminal of CLGN corresponding to a region with amino acids YKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEEL
Purity/Format Total IgG Protein A purified
Blocking Peptide Calmegin Blocking Peptide
Description Rabbit polyclonal Calmegin antibody raised against the N terminal of CLGN
Gene MMP1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.