TCP11 antibody

Name TCP11 antibody
Supplier Fitzgerald
Catalog 70R-3950
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen TCP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids CVCSVIDQRIHLFLKCCLVLGVQRSLLDLPGGLTLIEAELAELGQKFVNL
Purity/Format Affinity purified
Blocking Peptide TCP11 Blocking Peptide
Description Rabbit polyclonal TCP11 antibody
Gene TCP11
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.