| Name | KIAA0515 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3603 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | KIAA0515 antibody was raised using the N terminal of KIAA0515 corresponding to a region with amino acids ATASQPPESLPQPGLQKSVSNLQKPTQSISQENTNSVPGGPKSWAQLNGK |
| Purity/Format | Affinity purified |
| Blocking Peptide | KIAA0515 Blocking Peptide |
| Description | Rabbit polyclonal KIAA0515 antibody raised against the N terminal of KIAA0515 |
| Gene | PRRC2B |
| Supplier Page | Shop |