SLC16A1 antibody

Name SLC16A1 antibody
Supplier Fitzgerald
Catalog 70R-6795
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen SLC16A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGFL
Purity/Format Affinity purified
Blocking Peptide SLC16A1 Blocking Peptide
Description Rabbit polyclonal SLC16A1 antibody
Gene MCPH1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.