Name | OR6C70 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1722 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | OR6C70 antibody was raised using the C terminal of OR6C70 corresponding to a region with amino acids GSCMFIYIKPSANERVALSKGVTVLNTSVAPLLNPFIYTLRNQQVKQAFK |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | OR6C70 Blocking Peptide |
Description | Rabbit polyclonal OR6C70 antibody raised against the C terminal of OR6C70 |
Gene | OR6C70 |
Supplier Page | Shop |