| Name | OR6C70 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1722 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | OR6C70 antibody was raised using the C terminal of OR6C70 corresponding to a region with amino acids GSCMFIYIKPSANERVALSKGVTVLNTSVAPLLNPFIYTLRNQQVKQAFK |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | OR6C70 Blocking Peptide |
| Description | Rabbit polyclonal OR6C70 antibody raised against the C terminal of OR6C70 |
| Gene | OR6C70 |
| Supplier Page | Shop |