HECTD2 antibody

Name HECTD2 antibody
Supplier Fitzgerald
Catalog 70R-2821
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen HECTD2 antibody was raised using the C terminal of HECTD2 corresponding to a region with amino acids TDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMADLNFKISKNET
Purity/Format Affinity purified
Blocking Peptide HECTD2 Blocking Peptide
Description Rabbit polyclonal HECTD2 antibody raised against the C terminal of HECTD2
Gene HECTD2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.