| Name | CYP2C19 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5326 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CYP2C19 antibody was raised using the middle region of CYP2C19 corresponding to a region with amino acids QEEIERVIGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCD |
| Purity/Format | Affinity purified |
| Blocking Peptide | CYP2C19 Blocking Peptide |
| Description | Rabbit polyclonal CYP2C19 antibody raised against the middle region of CYP2C19 |
| Gene | CYP2C19 |
| Supplier Page | Shop |