LSM4 antibody

Name LSM4 antibody
Supplier Fitzgerald
Catalog 70R-4945
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen LSM4 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGK
Purity/Format Affinity purified
Blocking Peptide LSM4 Blocking Peptide
Description Rabbit polyclonal LSM4 antibody
Gene LSM4
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.