| Name | RALYL antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4982 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | RALYL antibody was raised using the C terminal of RALYL corresponding to a region with amino acids AQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFD |
| Purity/Format | Affinity purified |
| Blocking Peptide | RALYL Blocking Peptide |
| Description | Rabbit polyclonal RALYL antibody raised against the C terminal of RALYL |
| Gene | RALYL |
| Supplier Page | Shop |