| Name | KIAA1191 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4315 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | KIAA1191 antibody was raised using the middle region of KIAA1191 corresponding to a region with amino acids TPHSSPKQRPRGWFTSGSSTALPGPNPSTMDSGSGDKDRNLSDKWSLFGP |
| Purity/Format | Affinity purified |
| Blocking Peptide | KIAA1191 Blocking Peptide |
| Description | Rabbit polyclonal KIAA1191 antibody raised against the middle region of KIAA1191 |
| Gene | KIAA1191 |
| Supplier Page | Shop |