Name | KIAA1191 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4315 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | KIAA1191 antibody was raised using the middle region of KIAA1191 corresponding to a region with amino acids TPHSSPKQRPRGWFTSGSSTALPGPNPSTMDSGSGDKDRNLSDKWSLFGP |
Purity/Format | Affinity purified |
Blocking Peptide | KIAA1191 Blocking Peptide |
Description | Rabbit polyclonal KIAA1191 antibody raised against the middle region of KIAA1191 |
Gene | KIAA1191 |
Supplier Page | Shop |