| Name | EPB42 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3611 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | EPB42 antibody was raised using the middle region of EPB42 corresponding to a region with amino acids ISTKGVGSDRCEDITQNYKYPEGSLQEKEVLERVEKEKMEREKDNGIRPP |
| Purity/Format | Affinity purified |
| Blocking Peptide | EPB42 Blocking Peptide |
| Description | Rabbit polyclonal EPB42 antibody raised against the middle region of EPB42 |
| Gene | EPB42 |
| Supplier Page | Shop |