Name | WDR63 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4155 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | WDR63 antibody was raised using the middle region of WDR63 corresponding to a region with amino acids EIALQQNEIMNTFIDDWKYLAEEEGTFGDKTDTHLKEYQSFTDLHSPTEK |
Purity/Format | Affinity purified |
Blocking Peptide | WDR63 Blocking Peptide |
Description | Rabbit polyclonal WDR63 antibody raised against the middle region of WDR63 |
Gene | WDR63 |
Supplier Page | Shop |