| Name | RAB40C antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3451 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | RAB40C antibody was raised using the N terminal of RAB40C corresponding to a region with amino acids QDGAAESPYAYSNGIDYKTTTILLDGRRVRLELWDTSGQGRFCTIFRSYS |
| Purity/Format | Affinity purified |
| Blocking Peptide | RAB40C Blocking Peptide |
| Description | Rabbit polyclonal RAB40C antibody raised against the N terminal of RAB40C |
| Gene | RAB40C |
| Supplier Page | Shop |