| Name | RBM7 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4859 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | RBM7 antibody was raised using the middle region of RBM7 corresponding to a region with amino acids SFNQSSSSQWRQGTPSSQRKVRMNSYPYLADRHYSREQRYTDHGSDHHYR |
| Purity/Format | Affinity purified |
| Blocking Peptide | RBM7 Blocking Peptide |
| Description | Rabbit polyclonal RBM7 antibody raised against the middle region of RBM7 |
| Gene | RBM7 |
| Supplier Page | Shop |